Cytokeratin 13 Antikörper (N-Term)

Produktnummer ABIN630838

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch Cytokeratin 13 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Cytokeratin 13 Antikörper (N-Term) (ABIN630838)

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cytokeratin 13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cytokeratin 13 Antikörper

Bindungsspezifität: N-Term

Spezifität: Cytokeratin 13 antibody was raised against the N terminal of KRT13

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 13 antibody was raised using the N terminal of KRT13 corresponding to a region with amino acids TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 13 Blocking Peptide, (ABIN5613103), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cytokeratin 13

Target: Cytokeratin 13 (KRT13) (Keratin 13 (KRT13))

Andere Bezeichnung: Cytokeratin 13

Hintergrund: KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins.

Molekulargewicht: 46 kDa (MW of target protein)